| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) ![]() |
| Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
| Protein GroEL, A domain [52031] (4 species) |
| Species Escherichia coli [TaxId:562] [52032] (18 PDB entries) |
| Domain d1dkdb_: 1dkd B: [30776] missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1dkd (more details), 2.1 Å
SCOPe Domain Sequences for d1dkdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkdb_ c.8.5.1 (B:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv
Timeline for d1dkdb_: