Lineage for d1fyaa1 (1fya A:191-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851159Protein GroEL, A domain [52031] (4 species)
  7. 2851160Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 2851162Domain d1fyaa1: 1fya A:191-376 [30774]
    Other proteins in same PDB: d1fyaa2
    complexed with gol; mutant

Details for d1fyaa1

PDB Entry: 1fya (more details), 2.2 Å

PDB Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain
PDB Compounds: (A:) 60 kd chaperonin

SCOPe Domain Sequences for d1fyaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyaa1 c.8.5.1 (A:191-376) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgevelespfilltdkkisnirellpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseelgmkle
katledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqerva
klaggv

SCOPe Domain Coordinates for d1fyaa1:

Click to download the PDB-style file with coordinates for d1fyaa1.
(The format of our PDB-style files is described here.)

Timeline for d1fyaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fyaa2