Lineage for d4ms2a_ (4ms2 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023737Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 3023738Protein CavAb calcium channel [310745] (1 species)
  7. 3023739Species Arcobacter butzleri [TaxId:367737] [310998] (1 PDB entry)
  8. 3023740Domain d4ms2a_: 4ms2 A: [307737]
    complexed with ca, px4

Details for d4ms2a_

PDB Entry: 4ms2 (more details), 2.75 Å

PDB Description: Structural basis of Ca2+ selectivity of a voltage-gated calcium channel
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d4ms2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ms2a_ f.14.1.2 (A:) CavAb calcium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
ngivrplmevypyawvffipfifvvtfvminlvvaicvd

SCOPe Domain Coordinates for d4ms2a_:

Click to download the PDB-style file with coordinates for d4ms2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ms2a_: