Lineage for d1dk7b_ (1dk7 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67680Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 67681Family c.8.5.1: GroEL [52030] (1 protein)
  6. 67682Protein GroEL [52031] (2 species)
  7. 67683Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 67686Domain d1dk7b_: 1dk7 B: [30773]

Details for d1dk7b_

PDB Entry: 1dk7 (more details), 2.02 Å

PDB Description: crystal structure of an isolated apical domain of groel

SCOP Domain Sequences for d1dk7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk7b_ c.8.5.1 (B:) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1dk7b_:

Click to download the PDB-style file with coordinates for d1dk7b_.
(The format of our PDB-style files is described here.)

Timeline for d1dk7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dk7a_