Lineage for d1dk7b_ (1dk7 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. Protein GroEL, A domain [52031] (4 species)
  7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. Domain d1dk7b_: 1dk7 B: [30773]

Details for d1dk7b_

PDB Entry: 1dk7 (more details), 2.02 Å

PDB Description: crystal structure of an isolated apical domain of groel
PDB Compounds: (B:) groEL

SCOPe Domain Sequences for d1dk7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk7b_ c.8.5.1 (B:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOPe Domain Coordinates for d1dk7b_ are not available.

Timeline for d1dk7b_:

Domains from other chains:
(mouse over for more information)
d1dk7a_