Lineage for d4mcmi_ (4mcm I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763832Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)
  8. 2764176Domain d4mcmi_: 4mcm I: [307727]
    automated match to d2c9va_
    complexed with so4, zn; mutant

Details for d4mcmi_

PDB Entry: 4mcm (more details), 2.2 Å

PDB Description: Human SOD1 C57S Mutant, As-isolated
PDB Compounds: (I:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4mcmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcmi_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagstsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d4mcmi_:

Click to download the PDB-style file with coordinates for d4mcmi_.
(The format of our PDB-style files is described here.)

Timeline for d4mcmi_: