Lineage for d4lxwa_ (4lxw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014755Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2014756Protein automated matches [196409] (37 species)
    not a true protein
  7. 2014893Species Streptomyces coelicolor [TaxId:100226] [279808] (16 PDB entries)
  8. 2014901Domain d4lxwa_: 4lxw A: [307712]
    automated match to d5dz2a_
    complexed with btm, gol, mg, pop, so4

Details for d4lxwa_

PDB Entry: 4lxw (more details), 2.09 Å

PDB Description: L72V Epi-isozizaene synthase: Complex with Mg, inorganic pyrophosphate and benzyl triethyl ammonium cation
PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d4lxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lxwa_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdvmag
yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
ltfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn

SCOPe Domain Coordinates for d4lxwa_:

Click to download the PDB-style file with coordinates for d4lxwa_.
(The format of our PDB-style files is described here.)

Timeline for d4lxwa_: