Lineage for d1kida_ (1kid A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823456Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 823611Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 823612Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 823613Protein GroEL, A domain [52031] (4 species)
  7. 823614Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 823615Domain d1kida_: 1kid A: [30771]
    separately expressed fragment
    mutant

Details for d1kida_

PDB Entry: 1kid (more details), 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191- 376, mutant with ala 262 replaced with leu and ile 267 replaced with met
PDB Compounds: (A:) groEL (hsp60 class)

SCOP Domain Sequences for d1kida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOP Domain Coordinates for d1kida_:

Click to download the PDB-style file with coordinates for d1kida_.
(The format of our PDB-style files is described here.)

Timeline for d1kida_: