![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
![]() | Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
![]() | Protein GroEL, A domain [52031] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
![]() | Domain d1kida_: 1kid A: [30771] separately expressed fragment mutant |
PDB Entry: 1kid (more details), 1.7 Å
SCOP Domain Sequences for d1kida_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre klqervaklaggv
Timeline for d1kida_: