SCOP 1.55: Domain d1kid__: 1kid -

Lineage for d1kid__ (1kid -)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families)

5. Family c.8.5.1: GroEL [52030] (1 protein)

6. Protein GroEL [52031] (2 species)

7. Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)

8. Domain d1kid__: 1kid - [30771]

Details for d1kid__

PDB Entry: 1kid, 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191- 376, mutant with ala 262 replaced with leu and ile 267 replaced with met

SCOP Domain Sequences for d1kid__:

Sequence; same for both SEQRES and ATOM records:

>d1kid__ c.8.5.1 (-) GroEL {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

Timeline for d1kid__:

• d1kid__ appears in SCOP 1.57
  
• d1kid__ appears in the current release, SCOPe 2.08, called d1kida_