Lineage for d4lx1a_ (4lx1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008071Protein automated matches [310888] (2 species)
    not a true protein
  7. 2008074Species Human (Homo sapiens) [TaxId:9606] [311399] (4 PDB entries)
  8. 2008075Domain d4lx1a_: 4lx1 A: [307708]
    automated match to d4j5ma_
    complexed with edo, gol, so4, trs

Details for d4lx1a_

PDB Entry: 4lx1 (more details), 1.87 Å

PDB Description: Crystal structure of Myo5a globular tail domain
PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4lx1a_:

Sequence, based on SEQRES records: (download)

>d4lx1a_ a.118.27.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrts
siadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmc
swskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmc
nalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpf
npsslaletiqipaslglgfisrv

Sequence, based on observed residues (ATOM records): (download)

>d4lx1a_ a.118.27.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetytldsilrqlnsfhsvm
cqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlrdknl
mnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvnefeer
vsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfisrv

SCOPe Domain Coordinates for d4lx1a_:

Click to download the PDB-style file with coordinates for d4lx1a_.
(The format of our PDB-style files is described here.)

Timeline for d4lx1a_:

  • d4lx1a_ is new in SCOPe 2.06-stable