Lineage for d4luua_ (4luu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344939Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2344940Protein automated matches [196409] (45 species)
    not a true protein
  7. 2345119Species Streptomyces coelicolor [TaxId:100226] [279808] (22 PDB entries)
  8. 2345128Domain d4luua_: 4luu A: [307707]
    automated match to d5dz2a_
    complexed with btm, gol, mg, pop, so4

Details for d4luua_

PDB Entry: 4luu (more details), 1.95 Å

PDB Description: V329A Epi-isozizaene synthase: Complex with Mg, inorganic pyrophosphate and benzyl triethyl ammonium cation
PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d4luua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4luua_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
ltfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
ranvgnmrnwfssaywfhhesgrymvdswddrstppyvnn

SCOPe Domain Coordinates for d4luua_:

Click to download the PDB-style file with coordinates for d4luua_.
(The format of our PDB-style files is described here.)

Timeline for d4luua_: