![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
![]() | Protein Cut A1 [89931] (5 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [102974] (10 PDB entries) Uniprot O58720 |
![]() | Domain d4lu8c_: 4lu8 C: [307703] automated match to d1ukua_ complexed with co, so4 |
PDB Entry: 4lu8 (more details), 2 Å
SCOPe Domain Sequences for d4lu8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lu8c_ d.58.5.2 (C:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]} miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
Timeline for d4lu8c_: