SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lu7a_ (4lu7 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173456Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2173603Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 protein domains)
  6. 2173604Protein Cut A1 [89931] (5 species)
  7. 2173632Species Pyrococcus horikoshii [TaxId:53953] [102974] (10 PDB entries)
    Uniprot O58720
  8. 2173654Domain d4lu7a_: 4lu7 A: [307695]
    automated match to d1ukua_
    complexed with cl, cu, mes, so4

Details for d4lu7a_

PDB Entry: 4lu7 (more details), 1.8 Å

PDB Description: Crystal structure of the periplasmic divalent cation tolerance protein cutA from pyrococcus horikoshii OT3 in the presence of CuCL2
PDB Compounds: (A:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4lu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lu7a_ d.58.5.2 (A:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOPe Domain Coordinates for d4lu7a_:

Click to download the PDB-style file with coordinates for d4lu7a_.
(The format of our PDB-style files is described here.)

Timeline for d4lu7a_:

  • d4lu7a_ is new in SCOPe 2.06-stable