Lineage for d4ltva_ (4ltv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011012Species Streptomyces coelicolor [TaxId:100226] [279808] (16 PDB entries)
  8. 2011024Domain d4ltva_: 4ltv A: [307693]
    automated match to d5dz2a_
    complexed with so4

Details for d4ltva_

PDB Entry: 4ltv (more details), 2.4 Å

PDB Description: Crystal structure of epi-isozizaene synthase from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d4ltva_:

Sequence, based on SEQRES records: (download)

>d4ltva_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy
ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed
tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrrl
tfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevhn
lgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgavr
anvgnmrnwfssvywfhhe

Sequence, based on observed residues (ATOM records): (download)

>d4ltva_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy
ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed
tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrrl
tfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkevhnlgisl
ithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgavranvgn
mrnwfssvywfhhe

SCOPe Domain Coordinates for d4ltva_:

Click to download the PDB-style file with coordinates for d4ltva_.
(The format of our PDB-style files is described here.)

Timeline for d4ltva_:

  • d4ltva_ is new in SCOPe 2.06-stable