![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein (Apo)ferritin [47246] (8 species) |
![]() | Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries) |
![]() | Domain d4lq7a_: 4lq7 A: [307692] automated match to d1mfra_ complexed with cl, fe, mg |
PDB Entry: 4lq7 (more details), 1.9 Å
SCOPe Domain Sequences for d4lq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lq7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d4lq7a_: