Lineage for d1cx8g2 (1cx8 G:190-382)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155496Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1155620Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 1155621Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 1155641Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 1155642Species Human (Homo sapiens) [TaxId:9606] [52028] (3 PDB entries)
  8. 1155652Domain d1cx8g2: 1cx8 G:190-382 [30769]
    Other proteins in same PDB: d1cx8a1, d1cx8a3, d1cx8b1, d1cx8b3, d1cx8c1, d1cx8c3, d1cx8d1, d1cx8d3, d1cx8e1, d1cx8e3, d1cx8f1, d1cx8f3, d1cx8g1, d1cx8g3, d1cx8h1, d1cx8h3
    complexed with nag, sm

Details for d1cx8g2

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor
PDB Compounds: (G:) transferrin receptor protein

SCOPe Domain Sequences for d1cx8g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8g2 c.8.4.1 (G:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

SCOPe Domain Coordinates for d1cx8g2:

Click to download the PDB-style file with coordinates for d1cx8g2.
(The format of our PDB-style files is described here.)

Timeline for d1cx8g2: