Lineage for d4llia1 (4lli A:1467-1855)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008048Protein MyoVa globular tail domain (GTD) [310806] (2 species)
  7. 2008049Species Human (Homo sapiens) [TaxId:9606] [311072] (2 PDB entries)
  8. 2008050Domain d4llia1: 4lli A:1467-1855 [307687]
    Other proteins in same PDB: d4llia2, d4llib2
    automated match to d4j5ma_

Details for d4llia1

PDB Entry: 4lli (more details), 2.2 Å

PDB Description: Crystal Structure of human Myosin 5a globular domain
PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4llia1:

Sequence, based on SEQRES records: (download)

>d4llia1 a.118.27.1 (A:1467-1855) MyoVa globular tail domain (GTD) {Human (Homo sapiens) [TaxId: 9606]}
prkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylndd
qkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqn
ehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptgl
rkrtssiadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlll
rkdmcswskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaea
icsmcnalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifp
vtfpfnpsslaletiqipaslglgfisrv

Sequence, based on observed residues (ATOM records): (download)

>d4llia1 a.118.27.1 (A:1467-1855) MyoVa globular tail domain (GTD) {Human (Homo sapiens) [TaxId: 9606]}
prkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylndd
qkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqn
ehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvstytldsi
lrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvs
qleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvln
lytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqip
aslglgfisrv

SCOPe Domain Coordinates for d4llia1:

Click to download the PDB-style file with coordinates for d4llia1.
(The format of our PDB-style files is described here.)

Timeline for d4llia1:

  • d4llia1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4llia2