SCOPe 2.06: Domain d4lgna1: 4lgn A:3-416

Lineage for d4lgna1 (4lgn A:3-416)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.0: automated matches [227242] (1 protein)
   not a true family

6. Protein automated matches [227008] (5 species)
   not a true protein

7. Species Acidothermus cellulolyticus [TaxId:351607] [311397] (1 PDB entry)

8. Domain d4lgna1: 4lgn A:3-416 [307683]
   automated match to d5fkqa1
   complexed with act, edo, fmt, gol, k, na

Details for d4lgna1

PDB Entry: 4lgn, 1.82 Å

PDB Description: The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase

PDB Compounds: (A:) Cellulose-binding, family II

SCOPe Domain Sequences for d4lgna1:

Sequence; same for both SEQRES and ATOM records:

>d4lgna1 b.69.13.0 (A:3-416) automated matches {Acidothermus cellulolyticus [TaxId: 351607]}
ttqpytwsnvaiggggfvdgivfnegapgilyvrtdiggmyrwdaangrwiplldwvgwn
nwgyngvvsiaadpintnkvwaavgmytnswdpndgailrssdqgatwqitplpfklggn
mpgrgmgerlavdpnndnilyfgapsgkglwrstdsgatwsqmtnfpdvgtyianptdtt
gyqsdiqgvvwvafdksssslgqasktifvgvadpnnpvfwsrdggatwqavpgaptgfi
phkgvfdpvnhvlyiatsntggpydgssgdvwkfsvtsgtwtrispvpstdtandyfgys
gltidrqhpntimvatqiswwpdtiifrstdggatwtriwdwtsypnrslryvldisaep
wltfgvqpnppvpspklgwmdeamaidpfnsdrmlygtgatlyatndltkwdsg

Timeline for d4lgna1:

• d4lgna1 is new in SCOPe 2.06-stable
  
• d4lgna1 appears in SCOPe 2.07
  
• d4lgna1 appears in the current release, SCOPe 2.08