Lineage for d4l8ta_ (4l8t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008068Protein MyoVc cargo binding domain [310808] (1 species)
  7. 2008069Species Human (Homo sapiens) [TaxId:9606] [311074] (1 PDB entry)
  8. 2008070Domain d4l8ta_: 4l8t A: [307682]

Details for d4l8ta_

PDB Entry: 4l8t (more details), 2.95 Å

PDB Description: Structure of the Cargo Binding Domain from Human Myosin Vc
PDB Compounds: (A:) Unconventional myosin-Vc

SCOPe Domain Sequences for d4l8ta_:

Sequence, based on SEQRES records: (download)

>d4l8ta_ a.118.27.1 (A:) MyoVc cargo binding domain {Human (Homo sapiens) [TaxId: 9606]}
eylgmlqykredeakliqnlildlkprgvvvnmipglpahilfmcvryadslndanmlks
lmnstingikqvvkehledfemlsfwlsntchflnclkqysgeeefmkhnspqqnkncln
nfdlseyrqilsdvairiyhqfiiimekniqpiivpgmleyeslqgisglkptgfrkrss
siddtdgytmtsvlqqlsyfyttmcqngldpelvrqavkqlffligavtlnslflrkdmc
scrkgmqircnisyleewlkdknlqnslaketleplsqaawllqvkkttdsdakeiyerc
tslsavqiikilnsytpiddfekrvtpsfvrkvqallnsredssqlmldtkylfqvtfpf
tpsphalemiqipssfklgflnrl

Sequence, based on observed residues (ATOM records): (download)

>d4l8ta_ a.118.27.1 (A:) MyoVc cargo binding domain {Human (Homo sapiens) [TaxId: 9606]}
eylgmlqykredeakliqnlildlkprgvvvnmipglpahilfmcvryadslndanmlks
lmnstingikqvvkehledfemlsfwlsntchflnclkqysgeeefmkhnspqqnkncln
nfdlseyrqilsdvairiyhqfiiimekniqpiivpgmleyeslqgytmtsvlqqlsyfy
ttmcqngldpelvrqavkqlffligavtlnslflrkdmcscrkgmqircnisyleewlkd
knlqnslaketleplsqaawllqvkkttdsdakeiyerctslsavqiikilnsytpiddf
ekrvtpsfvrkvqallnsredssqlmldtkylfqvtfpftpsphalemiqipssfklgfl
nrl

SCOPe Domain Coordinates for d4l8ta_:

Click to download the PDB-style file with coordinates for d4l8ta_.
(The format of our PDB-style files is described here.)

Timeline for d4l8ta_:

  • d4l8ta_ is new in SCOPe 2.06-stable