Lineage for d4l61a1 (4l61 A:1-403)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089888Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2089889Protein automated matches [190717] (5 species)
    not a true protein
  7. 2089898Species Candida albicans [TaxId:237561] [311396] (6 PDB entries)
  8. 2089903Domain d4l61a1: 4l61 A:1-403 [307672]
    automated match to d4qqua1
    complexed with met, zn

Details for d4l61a1

PDB Entry: 4l61 (more details), 2.13 Å

PDB Description: Crystal structure of the Candida albicans Methionine Synthase in complex with Methionine
PDB Compounds: (A:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

SCOPe Domain Sequences for d4l61a1:

Sequence, based on SEQRES records: (download)

>d4l61a1 c.1.22.0 (A:1-403) automated matches {Candida albicans [TaxId: 237561]}
mvqssvlgfpriggqrelkkiteaywsgkatveellakgkelrehnwklqqkagvdiips
ndfsyydqvldlsllfnaiperytkfdlapidvlfamgrglqaaatatqaavdvtalemv
kwfdsnyhyvrptfshstefklntaagikpvdefneakalgvqtrpvilgpvsylylgka
dkdsldlepisllpkilpvykellqklkeagaeqvqidepvlvldlpeavqskfkeayda
lvgadvpelilttyfgdvrpnlkaienlpvagfhfdfvrvpeqldevasilkdgqtlsag
vvdgrniwktdfakasavvqkaiekvgkdkvvvatsssllhtpvdlesetkldavikdwf
sfatqkldevvviaknvsgedvskqleanaasikarsessitn

Sequence, based on observed residues (ATOM records): (download)

>d4l61a1 c.1.22.0 (A:1-403) automated matches {Candida albicans [TaxId: 237561]}
mvqssvlgfpriggqrelkkiteaywsgkatveellakgkelrehnwklqqkagvdiips
ndfsyydqvldlsllfnaiperytkfdlapidvlfamgrglqaavtalemvkwfdsnyhy
vrptfshstefklntaagikpvdefneakalgvqtrpvilgpvsylylgkadkdsldlep
isllpkilpvykellqklkeagaeqvqidepvlvldlpeavqskfkeaydalvgadvpel
ilttyfgdvrpnlkaienlpvagfhfdfvrvpeqldevasilkdgqtlsagvvdgrniwk
tdfakasavvqkaiekvgkdkvvvatsssllhtpvdlesetkldavikdwfsfatqklde
vvviaknvsgedvskqleanaasikarsessitn

SCOPe Domain Coordinates for d4l61a1:

Click to download the PDB-style file with coordinates for d4l61a1.
(The format of our PDB-style files is described here.)

Timeline for d4l61a1:

  • d4l61a1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4l61a2