![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.14: PAZ domain [101690] (2 families) ![]() |
![]() | Family b.34.14.0: automated matches [310679] (1 protein) not a true family |
![]() | Protein automated matches [310889] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311392] (4 PDB entries) |
![]() | Domain d4kxta1: 4kxt A:22-410 [307665] Other proteins in same PDB: d4kxta2, d4kxta3 automated match to d4olaa1 protein/RNA complex |
PDB Entry: 4kxt (more details), 2.29 Å
SCOPe Domain Sequences for d4kxta1:
Sequence, based on SEQRES records: (download)
>d4kxta1 b.34.14.0 (A:22-410) automated matches {Human (Homo sapiens) [TaxId: 9606]} qaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymvqhfk pqifgdrkpvydgkkniytvtalpignervdfevtipgegkdrifkvsikwlaivswrml healvsgqipvplesvqaldvamrhlasmrytpvgrsffsppegyyhplgggrevwfgfh qsvrpamwkmmlnidvsatafykaqpviefmcevldirnideqpkpltdsqrvrftkeik glkvevthcgqmkrkyrvcnvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyp hlpclqvgqeqkhtylplevcnivagqrcikkltdnqtstmikatarsapdrqeeisrlm knasynldpyiqefgikvkddmtevtgrv
>d4kxta1 b.34.14.0 (A:22-410) automated matches {Human (Homo sapiens) [TaxId: 9606]} qaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymvqhfk pqifgdrkpvydgkkniytvtalpignervdkvsikwlaivswrmlhealvsgqipvple svqaldvamrhlasmrytpvgrsffsppegyyhplgggrevwfgfhqsvrpamwkmmlni dvsatafykaqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkr kyrvcnvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkht ylplevcnivagqrcikkltdnqtstmikatarsapdrqeeisrlmknasynldpyiqef gikvkddmtevtgrv
Timeline for d4kxta1: