SCOPe 2.06: Domain d4kvog_: 4kvo G:

Lineage for d4kvog_ (4kvo G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [311394] (3 PDB entries)

8. Domain d4kvog_: 4kvo G: [307661]
   automated match to d4lx9a_
   complexed with aco, cl, na, so4

Details for d4kvog_

PDB Entry: 4kvo, 3.15 Å

PDB Description: The NatA (Naa10p/Naa15p) amino-terminal acetyltrasferase complex bound to AcCoA

PDB Compounds: (G:) N-terminal acetyltransferase A complex catalytic subunit ard1

SCOPe Domain Sequences for d4kvog_:

Sequence; same for both SEQRES and ATOM records:

>d4kvog_ d.108.1.0 (G:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mdirparisdltgmqncnlhnlpenyqlkyylyhaiswpmlsyvatdpkgrvvgyvlakm
eeepkdgiphghitsvsvmrsyrhlglakrlmvqsqramvevygakymslhvrksnraai
hlyrdtlqfdvqgieskyyadgedayamhkdfs

Timeline for d4kvog_:

• d4kvog_ is new in SCOPe 2.06-stable
  
• d4kvog_ appears in SCOPe 2.07
  
• d4kvog_ appears in the current release, SCOPe 2.08