Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.4: PA domain [52025] (1 family) |
Family c.8.4.1: PA domain [52026] (2 proteins) |
Protein Transferrin receptor ectodomain, apical domain [52027] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52028] (4 PDB entries) |
Domain d1cx8d2: 1cx8 D:190-382 [30766] Other proteins in same PDB: d1cx8a1, d1cx8a3, d1cx8b1, d1cx8b3, d1cx8c1, d1cx8c3, d1cx8d1, d1cx8d3, d1cx8e1, d1cx8e3, d1cx8f1, d1cx8f3, d1cx8g1, d1cx8g3, d1cx8h1, d1cx8h3 complexed with nag, sm |
PDB Entry: 1cx8 (more details), 3.2 Å
SCOPe Domain Sequences for d1cx8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx8d2 c.8.4.1 (D:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse sknvkltvsnvlk
Timeline for d1cx8d2: