![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [311394] (3 PDB entries) |
![]() | Domain d4kvmf_: 4kvm F: [307656] automated match to d4lx9a_ complexed with 1xe, cl, so4 |
PDB Entry: 4kvm (more details), 2.6 Å
SCOPe Domain Sequences for d4kvmf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kvmf_ d.108.1.0 (F:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} mdirparisdltgmqncnlhnlpenyqlkyylyhaiswpmlsyvatdpkgrvvgyvlakm eeepkdgiphghitsvsvmrsyrhlglakrlmvqsqramvevygakymslhvrksnraai hlyrdtlqfdvqgieskyyadgedayamhkdfs
Timeline for d4kvmf_: