Lineage for d4krea3 (4kre A:576-857)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2124966Species Human (Homo sapiens) [TaxId:9606] [225370] (6 PDB entries)
  8. 2124967Domain d4krea3: 4kre A:576-857 [307649]
    Other proteins in same PDB: d4krea1, d4krea2
    automated match to d4olaa3
    protein/RNA complex

Details for d4krea3

PDB Entry: 4kre (more details), 1.75 Å

PDB Description: Structure of Human Argonaute-1 bound to endogenous Sf9 RNA
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d4krea3:

Sequence, based on SEQRES records: (download)

>d4krea3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqe
iiedlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekd
yqpgityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiq
gtsrpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhl
vdkehdsgegshisgqsngrdpqalakavqvhqdtlrtmyfa

Sequence, based on observed residues (ATOM records): (download)

>d4krea3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppkkpsitavvgsmdahpsrycatvrvqrprqeiied
lsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekdyqpg
ityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiqgtsr
pshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhlvdrd
pqalakavqvhqdtlrtmyfa

SCOPe Domain Coordinates for d4krea3:

Click to download the PDB-style file with coordinates for d4krea3.
(The format of our PDB-style files is described here.)

Timeline for d4krea3:

  • d4krea3 is new in SCOPe 2.06-stable