Lineage for d4krea2 (4kre A:411-575)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130803Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2130855Family c.44.3.0: automated matches [310677] (1 protein)
    not a true family
  6. 2130856Protein automated matches [310878] (2 species)
    not a true protein
  7. 2130857Species Human (Homo sapiens) [TaxId:9606] [311393] (4 PDB entries)
  8. 2130858Domain d4krea2: 4kre A:411-575 [307648]
    Other proteins in same PDB: d4krea1, d4krea3
    automated match to d4olaa2
    protein/RNA complex

Details for d4krea2

PDB Entry: 4kre (more details), 1.75 Å

PDB Description: Structure of Human Argonaute-1 bound to endogenous Sf9 RNA
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d4krea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krea2 c.44.3.0 (A:411-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpapilqyggrnraiatpnqgvwdmrgkqfyngieikvwaiacfapqkqcreevlknftd
qlrkiskdagmpiqgqpcfckyaqgadsvepmfrhlkntysglqliivilpgktpvyaev
krvgdtllgmatqcvqvknvvktspqtlsnlclkinvklgginni

SCOPe Domain Coordinates for d4krea2:

Click to download the PDB-style file with coordinates for d4krea2.
(The format of our PDB-style files is described here.)

Timeline for d4krea2: