Lineage for d4kp3b_ (4kp3 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008048Protein MyoVa globular tail domain (GTD) [310806] (2 species)
  7. 2008054Species Mouse (Mus musculus) [TaxId:10090] [311071] (2 PDB entries)
  8. 2008064Domain d4kp3b_: 4kp3 B: [307644]
    automated match to d4j5ma_

Details for d4kp3b_

PDB Entry: 4kp3 (more details), 2.4 Å

PDB Description: crystal structure of myova-gtd in complex with two cargos
PDB Compounds: (B:) Unconventional myosin-Va

SCOPe Domain Sequences for d4kp3b_:

Sequence, based on SEQRES records: (download)

>d4kp3b_ a.118.27.1 (B:) MyoVa globular tail domain (GTD) {Mouse (Mus musculus) [TaxId: 10090]}
dfqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrts
siadegtytldsilrqlnsfhsvmsqhgmdpelikqvvkqmfyivgaitlnnlllrkdmc
swskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmc
nalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpf
npsslaletiqipaslglgfiarv

Sequence, based on observed residues (ATOM records): (download)

>d4kp3b_ a.118.27.1 (B:) MyoVa globular tail domain (GTD) {Mouse (Mus musculus) [TaxId: 10090]}
dfqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetytldsilrqlnsfhsvm
sqhgmdpelikqvvkqmfyivgaitlnnlllrkdmcswskgmqirynvsqleewlrdknl
mnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpervsvsf
irtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfiarv

SCOPe Domain Coordinates for d4kp3b_:

Click to download the PDB-style file with coordinates for d4kp3b_.
(The format of our PDB-style files is described here.)

Timeline for d4kp3b_:

  • d4kp3b_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4kp3a_