Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [228276] (11 PDB entries) |
Domain d4kjfa_: 4kjf A: [307639] automated match to d4n11a_ complexed with mpd, mpo |
PDB Entry: 4kjf (more details), 0.95 Å
SCOPe Domain Sequences for d4kjfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kjfa_ c.47.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} eavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdmaniqay lkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn
Timeline for d4kjfa_: