Lineage for d1de4f2 (1de4 F:190-382)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21349Superfamily c.8.4: Transferrin receptor ectodomain, apical domain [52025] (1 family) (S)
  5. 21350Family c.8.4.1: Transferrin receptor ectodomain, apical domain [52026] (1 protein)
  6. 21351Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 21352Species Human (Homo sapiens) [TaxId:9606] [52028] (2 PDB entries)
  8. 21354Domain d1de4f2: 1de4 F:190-382 [30761]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b1, d1de4c1, d1de4c3, d1de4d1, d1de4d2, d1de4e1, d1de4f1, d1de4f3, d1de4g1, d1de4g2, d1de4h1, d1de4i1, d1de4i3

Details for d1de4f2

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4f2 c.8.4.1 (F:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens)}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

SCOP Domain Coordinates for d1de4f2:

Click to download the PDB-style file with coordinates for d1de4f2.
(The format of our PDB-style files is described here.)

Timeline for d1de4f2: