Lineage for d1de4f2 (1de4 F:190-382)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851100Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 2851101Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 2851141Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 2851142Species Human (Homo sapiens) [TaxId:9606] [52028] (4 PDB entries)
  8. 2851145Domain d1de4f2: 1de4 F:190-382 [30761]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c1, d1de4c3, d1de4d1, d1de4d2, d1de4e_, d1de4f1, d1de4f3, d1de4g1, d1de4g2, d1de4h_, d1de4i1, d1de4i3
    complexed with ca, gol, nag

Details for d1de4f2

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor
PDB Compounds: (F:) transferrin receptor

SCOPe Domain Sequences for d1de4f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4f2 c.8.4.1 (F:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

SCOPe Domain Coordinates for d1de4f2:

Click to download the PDB-style file with coordinates for d1de4f2.
(The format of our PDB-style files is described here.)

Timeline for d1de4f2: