Lineage for d4jk1y_ (4jk1 Y:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984585Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1984618Family a.4.13.2: Sigma4 domain [88665] (5 protein domains)
  6. 1984626Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 1984627Species Escherichia coli [TaxId:562] [116816] (3 PDB entries)
    Uniprot P00579 546-613
  8. 1984630Domain d4jk1y_: 4jk1 Y: [307607]
    protein/DNA complex; complexed with g4p, zn

Details for d4jk1y_

PDB Entry: 4jk1 (more details), 3.9 Å

PDB Description: X-ray crystal structure of Escherichia coli sigma70 holoenzyme in complex with Guanosine tetraphosphate (ppGpp)
PDB Compounds: (Y:) Escherichia coli RNA polymerase sigma70 subunit

SCOPe Domain Sequences for d4jk1y_:

Sequence, based on SEQRES records: (download)

>d4jk1y_ a.4.13.2 (Y:) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}
tdpvrmymremgtvelltregeidiakriedginqvqcsvaeypeaitylleqydrveae
earlsdlitgfvdpnaeedlaptathvgselsqedldddededeedgdddsadddnsidp
elarekfaelraqyvvtrdtikakgrshataqeeilklsevfkqfrlvpkqfdylvnsmr
vmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaiamnkpwseklhdvs
eevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemveanlrlvisiakky
tnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitrsiadqartiripv
hmietinklnrisrqmlqemgreptpeelaermlmpedkirkvlkiakepismetpigdd
edshlgdfiedttlelpldsatteslraathdvlagltareakvlrmrfgidmntdytle
evgkqfdvtrerirqieakalrklrhpsrsevlrs

Sequence, based on observed residues (ATOM records): (download)

>d4jk1y_ a.4.13.2 (Y:) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}
tdpvrmymremgtvelltregeidiakriedginqvqcsvaeypeaitylleqydrveae
idpelarekfaelraqyvvtrdtikakgrshataqeeilklsevfkqfrlvpkqfdylvn
smrvmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaiamnkpwseklh
dvseevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemveanlrlvisia
kkytnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitrsiadqartir
ipvhmietinklnrisrqmlqemgreptpeelaermlmpedkirkvlkiakepismetpi
gddedshlgdfiedttlelpldsatteslraathdvlagltareakvlrmrfgidmntdy
tleevgkqfdvtrerirqieakalrklrhpsrsevlrs

SCOPe Domain Coordinates for d4jk1y_:

Click to download the PDB-style file with coordinates for d4jk1y_.
(The format of our PDB-style files is described here.)

Timeline for d4jk1y_:

  • d4jk1y_ is new in SCOPe 2.06-stable