Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (8 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (8 PDB entries) |
Domain d4jhzb2: 4jhz B:182-273 [307603] Other proteins in same PDB: d4jhza1, d4jhza3, d4jhza4, d4jhzb1, d4jhzb3, d4jhzb4 automated match to d5czkb2 complexed with 1kv |
PDB Entry: 4jhz (more details), 2.83 Å
SCOPe Domain Sequences for d4jhzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jhzb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d4jhzb2:
View in 3D Domains from other chains: (mouse over for more information) d4jhza1, d4jhza2, d4jhza3, d4jhza4 |