Lineage for d4jhzb2 (4jhz B:182-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763185Domain d4jhzb2: 4jhz B:182-273 [307603]
    Other proteins in same PDB: d4jhza1, d4jhza3, d4jhza4, d4jhzb1, d4jhzb3, d4jhzb4
    automated match to d5czkb2
    complexed with 1kv

Details for d4jhzb2

PDB Entry: 4jhz (more details), 2.83 Å

PDB Description: Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d4jhzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jhzb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d4jhzb2:

Click to download the PDB-style file with coordinates for d4jhzb2.
(The format of our PDB-style files is described here.)

Timeline for d4jhzb2: