| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
| Domain d4jhzb1: 4jhz B:1-181 [307602] Other proteins in same PDB: d4jhza2, d4jhza3, d4jhza4, d4jhzb2, d4jhzb3, d4jhzb4 automated match to d5czkb1 complexed with 1kv |
PDB Entry: 4jhz (more details), 2.83 Å
SCOPe Domain Sequences for d4jhzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jhzb1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n
Timeline for d4jhzb1:
View in 3DDomains from other chains: (mouse over for more information) d4jhza1, d4jhza2, d4jhza3, d4jhza4 |