Lineage for d4j5ma_ (4j5m A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008065Protein MyoVb globular tail [310807] (1 species)
  7. 2008066Species Human (Homo sapiens) [TaxId:9606] [311073] (1 PDB entry)
  8. 2008067Domain d4j5ma_: 4j5m A: [307580]
    complexed with no3

Details for d4j5ma_

PDB Entry: 4j5m (more details), 2.07 Å

PDB Description: Structure of the Cargo Binding Domain from Human Myosin Vb
PDB Compounds: (A:) Unconventional myosin-Vb

SCOPe Domain Sequences for d4j5ma_:

Sequence, based on SEQRES records: (download)

>d4j5ma_ a.118.27.1 (A:) MyoVb globular tail {Human (Homo sapiens) [TaxId: 9606]}
vqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirhadytndd
lkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtqntakqn
ehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpmivsamlenesiqglsgvkptgy
rkrsssmadgdnsycleaiirqmnafhtvmcdqgldpeiilqvfkqlfyminavtlnnll
lrkdvcswstgmqlrynisqleewlrgrnlhqsgavqtmepliqaaqllqlkkktqedae
aicslctslstqqivkilnlytplnefeervtvafirtiqaqlqerndpqqllldakhmf
pvlfpfnpssltmdsihipaclnleflnev

Sequence, based on observed residues (ATOM records): (download)

>d4j5ma_ a.118.27.1 (A:) MyoVb globular tail {Human (Homo sapiens) [TaxId: 9606]}
vqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirhadytndd
lkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtqntakqn
ehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpmivsamlesycleaiirqmnafh
tvmcdqgldpeiilqvfkqlfyminavtlnnlllrkdvcswstgmqlrynisqleewlrg
rnlhqsgavqtmepliqaaqllqlkkktqedaeaicslctslstqqivkilnlytplnef
eervtvafirtiqaqlqerndpqqllldakhmfpvlfpfnpssltmdsihipaclnlefl
nev

SCOPe Domain Coordinates for d4j5ma_:

Click to download the PDB-style file with coordinates for d4j5ma_.
(The format of our PDB-style files is described here.)

Timeline for d4j5ma_:

  • d4j5ma_ is new in SCOPe 2.06-stable