Lineage for d4j5la_ (4j5l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008048Protein MyoVa globular tail domain (GTD) [310806] (2 species)
  7. 2008049Species Human (Homo sapiens) [TaxId:9606] [311072] (2 PDB entries)
  8. 2008052Domain d4j5la_: 4j5l A: [307578]
    complexed with so4

Details for d4j5la_

PDB Entry: 4j5l (more details), 2.2 Å

PDB Description: structure of the cargo binding domain from human myosin va
PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4j5la_:

Sequence, based on SEQRES records: (download)

>d4j5la_ a.118.27.1 (A:) MyoVa globular tail domain (GTD) {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrtss
iadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcs
wskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcn
alttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfn
psslaletiqipaslglgfisrv

Sequence, based on observed residues (ATOM records): (download)

>d4j5la_ a.118.27.1 (A:) MyoVa globular tail domain (GTD) {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsdegtytldsilrq
lnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqle
ewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlyt
pvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipasl
glgfisrv

SCOPe Domain Coordinates for d4j5la_:

Click to download the PDB-style file with coordinates for d4j5la_.
(The format of our PDB-style files is described here.)

Timeline for d4j5la_:

  • d4j5la_ is new in SCOPe 2.06-stable