Lineage for d4j4yc_ (4j4y C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016999Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2017000Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2017001Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 protein domains)
  6. 2017037Protein automated matches [310887] (1 species)
    not a true protein
  7. 2017038Species Granada virus [TaxId:904668] [311388] (2 PDB entries)
  8. 2017047Domain d4j4yc_: 4j4y C: [307576]
    automated match to d4h5la_
    mutant

Details for d4j4yc_

PDB Entry: 4j4y (more details), 2.45 Å

PDB Description: Triple mutant GraVN
PDB Compounds: (C:) NP protein

SCOPe Domain Sequences for d4j4yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4yc_ a.299.1.1 (C:) automated matches {Granada virus [TaxId: 904668]}
ednyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmm
ivlnlvdgnepesmmkemsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvq
alktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlef
sktinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiek
caekykakvgk

SCOPe Domain Coordinates for d4j4yc_:

Click to download the PDB-style file with coordinates for d4j4yc_.
(The format of our PDB-style files is described here.)

Timeline for d4j4yc_:

  • d4j4yc_ is new in SCOPe 2.06-stable