Lineage for d4j4xf_ (4j4x F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739394Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2739395Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2739396Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2739432Protein automated matches [310887] (1 species)
    not a true protein
  7. 2739433Species Granada virus [TaxId:904668] [311388] (2 PDB entries)
  8. 2739439Domain d4j4xf_: 4j4x F: [307573]
    automated match to d4h5la_

Details for d4j4xf_

PDB Entry: 4j4x (more details), 2.51 Å

PDB Description: Crystal structure of GraVN
PDB Compounds: (F:) NP protein

SCOPe Domain Sequences for d4j4xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4xf_ a.299.1.1 (F:) automated matches {Granada virus [TaxId: 904668]}
nyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmmiv
lnlvrgnkpesmmkkmsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvqal
ktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlefsk
tinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiekca
ekykakvg

SCOPe Domain Coordinates for d4j4xf_:

Click to download the PDB-style file with coordinates for d4j4xf_.
(The format of our PDB-style files is described here.)

Timeline for d4j4xf_: