![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily) |
![]() | Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) ![]() Pfam PF05733 |
![]() | Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins) |
![]() | Protein automated matches [310887] (1 species) not a true protein |
![]() | Species Granada virus [TaxId:904668] [311388] (2 PDB entries) |
![]() | Domain d4j4xd_: 4j4x D: [307571] automated match to d4h5la_ |
PDB Entry: 4j4x (more details), 2.51 Å
SCOPe Domain Sequences for d4j4xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4xd_ a.299.1.1 (D:) automated matches {Granada virus [TaxId: 904668]} nyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmmiv lnlvrgnkpesmmkkmsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvqal ktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlefsk tinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiekca ekykakvgk
Timeline for d4j4xd_: