Lineage for d4j4xc_ (4j4x C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739394Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2739395Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2739396Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2739432Protein automated matches [310887] (1 species)
    not a true protein
  7. 2739433Species Granada virus [TaxId:904668] [311388] (2 PDB entries)
  8. 2739436Domain d4j4xc_: 4j4x C: [307570]
    automated match to d4h5la_

Details for d4j4xc_

PDB Entry: 4j4x (more details), 2.51 Å

PDB Description: Crystal structure of GraVN
PDB Compounds: (C:) NP protein

SCOPe Domain Sequences for d4j4xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4xc_ a.299.1.1 (C:) automated matches {Granada virus [TaxId: 904668]}
nyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmmiv
lnlvrgnkpesmmkkmsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvqal
ktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlefsk
tinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiekca
ekykak

SCOPe Domain Coordinates for d4j4xc_:

Click to download the PDB-style file with coordinates for d4j4xc_.
(The format of our PDB-style files is described here.)

Timeline for d4j4xc_: