SCOPe 2.08: Domain d4j4ja1: 4j4j A:218-373

Lineage for d4j4ja1 (4j4j A:218-373)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein APOBEC3F [310758] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311013] (5 PDB entries)

8. Domain d4j4ja1: 4j4j A:218-373 [307563]
   Other proteins in same PDB: d4j4ja2, d4j4jb2
   automated match to d2nyta_
   complexed with zn

Details for d4j4ja1

PDB Entry: 4j4j, 3.1 Å

PDB Description: Crystal structure of the APOBEC3F Vif binding domain

PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3F

SCOPe Domain Sequences for d4j4ja1:

Sequence; same for both SEQRES and ATOM records:

>d4j4ja1 c.97.1.6 (A:218-373) APOBEC3F {Human (Homo sapiens) [TaxId: 9606]}
lcftmevvkhhspvswkrgvfrnqvdpethchaercflswfcddilspntnyevtwytsw
spcpecagevaeflarhsnvnltiftarlyyfwdtdyqeglrslsqegasveimgykdfk
ycwenfvynddepfkpwkglkynflfldsklqeile

Timeline for d4j4ja1:

• d4j4ja1 first appeared in SCOPe 2.06
  
• d4j4ja1 appears in SCOPe 2.07