Lineage for d4iouc_ (4iou C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2489937Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2490148Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 protein domains)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2490160Protein APOBEC3F [310758] (1 species)
  7. 2490161Species Human (Homo sapiens) [TaxId:9606] [311013] (5 PDB entries)
  8. 2490166Domain d4iouc_: 4iou C: [307558]
    automated match to d4ioua_
    complexed with zn

Details for d4iouc_

PDB Entry: 4iou (more details), 2.75 Å

PDB Description: Crystal structure of the HIV-1 Vif binding, catalytically active domain of APOBEC3F
PDB Compounds: (C:) DNA dC->dU-editing enzyme APOBEC-3F

SCOPe Domain Sequences for d4iouc_:

Sequence, based on SEQRES records: (download)

>d4iouc_ c.97.1.6 (C:) APOBEC3F {Human (Homo sapiens) [TaxId: 9606]}
npmeamdphifyfhfknlrkaygrneswlcftmevvkhhspvswkrgvfrnqvdpetgrh
aercflswfaddilspntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyf
ddtdaaeglrslsqegasveimgykdfkycwenfvynddepfkpwdgldynfldldsklq
eile

Sequence, based on observed residues (ATOM records): (download)

>d4iouc_ c.97.1.6 (C:) APOBEC3F {Human (Homo sapiens) [TaxId: 9606]}
npmeamdphifyfhfknlrkaygrneswlcftmevvkhhspvswkrgvfrnqhaercfls
wfaddilspntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyfddtdaae
glrslsqegasveimgykdfkycwenfvynddepfkpwdgldynfldldsklqeile

SCOPe Domain Coordinates for d4iouc_:

Click to download the PDB-style file with coordinates for d4iouc_.
(The format of our PDB-style files is described here.)

Timeline for d4iouc_: