SCOPe 2.08: Domain d4iogd_: 4iog D:

Lineage for d4iogd_ (4iog D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries)

8. Domain d4iogd_: 4iog D: [307555]
   Other proteins in same PDB: d4ioga2, d4iogb2, d4iogc2
   automated match to d4j11b_

Details for d4iogd_

PDB Entry: 4iog, 1.44 Å

PDB Description: The crystal structure of a secreted protein EsxB (wild-type, in P21 space group) from Bacillus anthracis str. Sterne

PDB Compounds: (D:) Secreted protein EsxB

SCOPe Domain Sequences for d4iogd_:

Sequence; same for both SEQRES and ATOM records:

>d4iogd_ a.25.3.0 (D:) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskq
amqqyipilegistdlkriadkfrnt

Timeline for d4iogd_:

• d4iogd_ first appeared in SCOPe 2.06
  
• d4iogd_ appears in SCOPe 2.07