Lineage for d1bxrh1 (1bxr H:2-152)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 479799Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 479800Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 479801Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 479802Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
  8. 479834Domain d1bxrh1: 1bxr H:2-152 [30755]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh2

Details for d1bxrh1

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrh1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1bxrh1:

Click to download the PDB-style file with coordinates for d1bxrh1.
(The format of our PDB-style files is described here.)

Timeline for d1bxrh1: