SCOPe 2.06: Domain d4ioga1: 4iog A:1-85

Lineage for d4ioga1 (4iog A:1-85)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries)

8. Domain d4ioga1: 4iog A:1-85 [307549]
   Other proteins in same PDB: d4ioga2, d4iogb2, d4iogc2
   automated match to d4j11b_

Details for d4ioga1

PDB Entry: 4iog, 1.44 Å

PDB Description: The crystal structure of a secreted protein EsxB (wild-type, in P21 space group) from Bacillus anthracis str. Sterne

PDB Compounds: (A:) Secreted protein EsxB

SCOPe Domain Sequences for d4ioga1:

Sequence; same for both SEQRES and ATOM records:

>d4ioga1 a.25.3.0 (A:1-85) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskq
amqqyipilegistdlkriadkfrn

Timeline for d4ioga1:

• d4ioga1 is new in SCOPe 2.06-stable
  
• d4ioga1 appears in SCOPe 2.07
  
• d4ioga1 appears in the current release, SCOPe 2.08