![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.38: MFS general substrate transporter [103472] (1 superfamily) 12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar |
![]() | Superfamily f.38.1: MFS general substrate transporter [103473] (4 families) ![]() |
![]() | Family f.38.1.3: Proton-dependent oligopeptide transporter (POT or PTR2) / nitrate transporter NRT1 family [310629] (2 proteins) Pfam PF00854; microbial members have 2 additional helices between H6 and H7 |
![]() | Protein Microbial PepT or POT [310739] (3 species) |
![]() | Species Geobacillus kaustophilus [TaxId:1462] [310992] (5 PDB entries) |
![]() | Domain d4ikva_: 4ikv A: [307538] automated match to d4ikza_ complexed with ola, olb, pg4, so4 |
PDB Entry: 4ikv (more details), 1.9 Å
SCOPe Domain Sequences for d4ikva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ikva_ f.38.1.3 (A:) Microbial PepT or POT {Geobacillus kaustophilus [TaxId: 1462]} asidkqqiaasvpqrgffghpkglftlfftefwerfsyygmrailvyymyyevskgglgl dehlalaimsiygalvymsgiiggwladrvfgtsravfyggllimaghialaipggvaal fvsmalivlgtgllkpnvssivgdmykpgddrrdagfsifymginlgaflaplvvgtagm kynfhlgfglaavgmflglvvfvatrkknlglagtyvpnpltpaekkkaaaimavgavvi avllailipngwftvetfislvgilgiiipiiyfvvmyrspkttaeersrviayiplfva samfwaiqeqgstilanyadkrtqldvagihlspawfqslnplfiiilapvfawmwvklg krqptipqkfalgllfaglsfivilvpghlsggglvhpiwlvlsyfivvlgelclspvgl sattklapaafsaqtmslwflsnaaaqainaqlvrfytpenetayfgtiggaalvlglil laiaprigrlmk
Timeline for d4ikva_: