SCOPe 2.06: Domain d4i7ga2: 4i7g A:430-554

Lineage for d4i7ga2 (4i7g A:430-554)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)

8. Domain d4i7ga2: 4i7g A:430-554 [307536]
   Other proteins in same PDB: d4i7ga1, d4i7gb_
   automated match to d1dloa1
   protein/DNA complex; protein/RNA complex; complexed with 1cj, dms, t27

Details for d4i7ga2

PDB Entry: 4i7g, 1.85 Å

PDB Description: HIV-1 reverse transcriptase with bound fragment at NNRTI adjacent site

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66 RT

SCOPe Domain Sequences for d4i7ga2:

Sequence; same for both SEQRES and ATOM records:

>d4i7ga2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d4i7ga2:

• d4i7ga2 is new in SCOPe 2.06-stable
  
• d4i7ga2 appears in SCOPe 2.07
  
• d4i7ga2 appears in the current release, SCOPe 2.08