Lineage for d4i7ga2 (4i7g A:430-554)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887412Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)
  8. 2887413Domain d4i7ga2: 4i7g A:430-554 [307536]
    Other proteins in same PDB: d4i7ga1, d4i7gb_
    automated match to d1dloa1
    protein/DNA complex; protein/RNA complex; complexed with 1cj, dms, t27

Details for d4i7ga2

PDB Entry: 4i7g (more details), 1.85 Å

PDB Description: HIV-1 reverse transcriptase with bound fragment at NNRTI adjacent site
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66 RT

SCOPe Domain Sequences for d4i7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7ga2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d4i7ga2:

Click to download the PDB-style file with coordinates for d4i7ga2.
(The format of our PDB-style files is described here.)

Timeline for d4i7ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i7ga1
View in 3D
Domains from other chains:
(mouse over for more information)
d4i7gb_