![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) ![]() |
![]() | Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52024] (10 PDB entries) |
![]() | Domain d1bxrd1: 1bxr D:2-152 [30753] Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh2 |
PDB Entry: 1bxr (more details), 2.1 Å
SCOP Domain Sequences for d1bxrd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxrd1 c.8.3.1 (D:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]} iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl lrekgaqngciiagdnpdaalalekarafpg
Timeline for d1bxrd1:
![]() Domains from other chains: (mouse over for more information) d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2 |